NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GOS2229_1046681

Scaffold GOS2229_1046681


Overview

Basic Information
Taxon OID3300001963 Open in IMG/M
Scaffold IDGOS2229_1046681 Open in IMG/M
Source Dataset NameMarine microbial communities from Nags Head, North Carolina, USA - GS013
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)864
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location NameNags Head, North Carolina, USA
CoordinatesLat. (o)35.6Long. (o)-75.82Alt. (m)Depth (m)2.1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023854Metagenome / Metatranscriptome208N

Sequences

Protein IDFamilyRBSSequence
GOS2229_10466812F023854N/AMTKTQVSPYIIIIIIFLNLTTNFANANDEDWIFLRCVKSSDNIKYFEVSVSREMMIERNGYQFTFTRLT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.