Scaffold GOS2245_1090478

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GOS2245_1090478

Scaffold GOS2245_1090478

Overview

Basic Information
Taxon OID	3300001966 Open in IMG/M
Scaffold ID	GOS2245_1090478 Open in IMG/M
Source Dataset Name	Marine microbial communities from Roca Redonda, Equador - GS030
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	940
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location Name	Roca Redonda, Equador
Coordinates	Lat. (^o)	0.27222222	Long. (^o)	-91.63333	Alt. (m)		Depth (m)	19
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103871	Metagenome / Metatranscriptome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2245_10904782	F103871	AGG	MVQIPGLILDYSKKKPPTKAVVCKTYDALAGFIKRPQVALTRR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.