NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GOS2233_1033909

Scaffold GOS2233_1033909


Overview

Basic Information
Taxon OID3300001969 Open in IMG/M
Scaffold IDGOS2233_1033909 Open in IMG/M
Source Dataset NameMarine microbial communities from Yucatan Channel, Mexico - GS017
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1806
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location NameYucatan Channel, Mexico
CoordinatesLat. (o)20.5225Long. (o)-85.41361Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001026Metagenome / Metatranscriptome802Y
F020546Metagenome / Metatranscriptome223Y
F094001Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
GOS2233_10339091F094001AGGAGGMNELLLPPDTPIQYEEGLWELCTDKAYEMMKHKRQFLDDDIFNYQIEYWTNKIFEANSHLRGID*
GOS2233_10339092F001026GAGGMALHTLKLDDLELTALITHLEGQNEIMCESRLNCSNPSETPDREEVLLNLVYEKVFKIGWDADKNPKVDFNLIQNIDRIYK*
GOS2233_10339095F020546N/ATDPNQNYTIKEFYIKVKGDYGKEKTMRVNDLGDKLTTLIDDLGWDYQRMSCSGREIYDEIQQLLGAIPENEVYMEI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.