Basic Information | |
---|---|
Taxon OID | 3300001969 Open in IMG/M |
Scaffold ID | GOS2233_1088611 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Yucatan Channel, Mexico - GS017 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 751 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Yucatan Channel, Mexico | |||||||
Coordinates | Lat. (o) | 20.5225 | Long. (o) | -85.41361 | Alt. (m) | Depth (m) | 2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F027202 | Metagenome / Metatranscriptome | 195 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
GOS2233_10886112 | F027202 | AGGA | MQKEIFFTPEEMQIIRVCLHNAPIPYDQGEGAKELKLLQEKVGPPISREEEGEVLVECDLEQYL* |
⦗Top⦘ |