Scaffold GOS2248_10042931

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GOS2248_10042931

Scaffold GOS2248_10042931

Overview

Basic Information
Taxon OID	3300001970 Open in IMG/M
Scaffold ID	GOS2248_10042931 Open in IMG/M
Source Dataset Name	Hypersaline microbial communities from Punta Cormorant, Floreana Island, Equador - GS033
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3247
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (72.73%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location Name	Punta Cormorant, Floreana Island, Equador
Coordinates	Lat. (^o)	-1.2283334	Long. (^o)	-90.42917	Alt. (m)		Depth (m)	.2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074540	Metagenome	119	N

Sequences

Protein ID	Family	RBS	Sequence
GOS2248_1004293110	F074540	N/A	MQGEQLMLTMKTDRDTATIEGLPFGEHIEWVKKTHYAYCYSGSGRIVDSFSFAWEKNNPNMADFLDAATNFIDYYFEENEYVG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.