NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Draft_10341256

Scaffold Draft_10341256


Overview

Basic Information
Taxon OID3300001975 Open in IMG/M
Scaffold IDDraft_10341256 Open in IMG/M
Source Dataset NameBiogas fermenter microbial communities from the University of Hamburg, Germany
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)580
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Biogas Fermenter → Biogas Fermenter Microbial Communities From The University Of Hamburg, Germany

Source Dataset Sampling Location
Location NameUniversity of Hamburg, Germany
CoordinatesLat. (o)53.458783Long. (o)9.968812Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074777Metagenome / Metatranscriptome119Y

Sequences

Protein IDFamilyRBSSequence
Draft_103412561F074777N/AQWAEYANPYDTGDIAEFLTITTGEKWEVKAFTGYSQGDYCEVVYCVNHYTPERITEIGELWLGCGTEFCIEGYYGYFVPESIRWREGETLRKYLADSYGCEPEELEIYLYEGEHIVTDYRKNGLSRKEGSN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.