Basic Information | |
---|---|
Taxon OID | 3300002027 Open in IMG/M |
Scaffold ID | MIS_10120084 Open in IMG/M |
Source Dataset Name | Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1.5k-5k |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Michigan |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1884 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater → Sinkhole Freshwater Microbial Communities From Lake Huron, Us |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Middle Island Sinkhole, Lake Huron Michigan, USA | |||||||
Coordinates | Lat. (o) | 45.19843 | Long. (o) | -83.32721 | Alt. (m) | Depth (m) | 23 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003114 | Metagenome / Metatranscriptome | 506 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
MIS_101200843 | F003114 | N/A | VDELVGAQDASQRVWFCASFFGVECMCYEYTPPMKTPVTPESLLRDLAQIQRLERGSVSVLRQGPNGPYYNHQCYEDGRNVSRYVPAEQVEELKAALAEHQRFQQLVQQYVQLLVERTRAERQAGSKKKSPRPTSSWPKTRKSSS* |
⦗Top⦘ |