NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GOS24894_10276173

Scaffold GOS24894_10276173


Overview

Basic Information
Taxon OID3300002033 Open in IMG/M
Scaffold IDGOS24894_10276173 Open in IMG/M
Source Dataset NameMarine microbial communities from the Sargasso Sea - GS000a &b
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)952
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location NameSargasso Sea
CoordinatesLat. (o)31.175Long. (o)-64.32433Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F080005Metagenome / Metatranscriptome115N

Sequences

Protein IDFamilyRBSSequence
GOS24894_102761731F080005N/ARRTDTLYTLSDQTQILHREYSGMGGSEREWRIISTGRYFNRISYDISLPCFDGSGYEHLGIEGLGRLICIKEPRYSQRKNMVSYDILFEKNTILSQISISIFPNELFEDLYVLSYFGWSNDIDEAEKYDYVKYIQTEVDDICLSKYRKATRLEDL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.