Scaffold AA4_1001183

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold AA4_1001183

Scaffold AA4_1001183

Overview

Basic Information
Taxon OID	3300002056 Open in IMG/M
Scaffold ID	AA4_1001183 Open in IMG/M
Source Dataset Name	Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - A-A4
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8121
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (27.27%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface → Macroalgal Surface Microbial Communities

Source Dataset Sampling Location
Location Name	Botany Bay, Sydney, NSW, Australia
Coordinates	Lat. (^o)	-33.966629	Long. (^o)	151.166614	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028441	Metagenome / Metatranscriptome	191	Y

Sequences

Protein ID	Family	RBS	Sequence
AA4_10011832	F028441	N/A	MNKMTLKQLIKLENKSQVIWVVSPSLHYDVENKDFNEIVSVNLGQKAKYRYIVPATPAITKNMKLYQKMYGLTTEEMGNNFLLLPESEFNPFITETAIYDPTGECVACCAPATEDSKDVIKFNQQTAKMMCKSFKSIWKKYKRSNP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.