Basic Information | |
---|---|
Taxon OID | 3300002057 Open in IMG/M |
Scaffold ID | SA1_1001750 Open in IMG/M |
Source Dataset Name | Macroalgal surface ecosystem from Botany Bay, Galicia, Spain - SA1-P2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3252 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → unclassified Flavobacteriia → Flavobacteria bacterium MS190-1F | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface → Macroalgal Surface Microbial Communities |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Vigo, Galicia, Spain | |||||||
Coordinates | Lat. (o) | 42.52 | Long. (o) | -8.82 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F028441 | Metagenome / Metatranscriptome | 191 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
SA1_10017506 | F028441 | N/A | MKHTMTLKQLIKLENKADTVWVISPTLHYDTENKDFSELVSVNLDAKKKYRYIVPATKQVEKNLKLYQKMYKLTDKEMFTNFLLLPDCDFNGFLTETVIYNAGKECIACTAPPLESTNDIIKYGPKTAKAMAKQFKTTWKKYMRMNP* |
⦗Top⦘ |