Scaffold SR2_10091266

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold SR2_10091266

Scaffold SR2_10091266

Overview

Basic Information
Taxon OID	3300002064 Open in IMG/M
Scaffold ID	SR2_10091266 Open in IMG/M
Source Dataset Name	Macroalgal surface ecosystem from Botany Bay, Galicia, Spain - SR2-P2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	545
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface → Macroalgal Surface Microbial Communities

Source Dataset Sampling Location
Location Name	Vigo, Galicia, Spain
Coordinates	Lat. (^o)	42.52	Long. (^o)	-8.82	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028441	Metagenome / Metatranscriptome	191	Y

Sequences

Protein ID	Family	RBS	Sequence
SR2_100912661	F028441	N/A	MTLKQLIKIEDKAKEVWVISPTLHYDVDNKDFSEIVSVNLGEKTKYKYIVPATSTVLKNIRRYKKMYNATESDVANNFLILPESEFNPFITESAIYDATTKCIAVSAPATDHKNEIIKLNEATAK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.