NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGIcombinedJ21915_10032117

Scaffold JGIcombinedJ21915_10032117


Overview

Basic Information
Taxon OID3300002071 Open in IMG/M
Scaffold IDJGIcombinedJ21915_10032117 Open in IMG/M
Source Dataset NameBarrow Graham LP Ref core NGADG0011-312 (Barrow Graham LP Ref core NGADG0011-312,NGADG0011-212, ASSEMBLY_DATE=20131010)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2344
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Caldiserica/Cryosericota group → Candidatus Cryosericota → Candidatus Cryosericia → Candidatus Cryosericales → Candidatus Cryosericaceae → Candidatus Cryosericum(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location
Location NameBarrow Environmental Observatory site, Barrow, Alaska
CoordinatesLat. (o)71.29053Long. (o)-156.788654Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F086912Metagenome110N

Sequences

Protein IDFamilyRBSSequence
JGIcombinedJ21915_100321171F086912N/AGSNPTIPTSNYPNRRGTNMIEEFIQSLQQAEVEADGVIKAAREKVQTIGRDSESSLVTVRASAEXSLQRRLXPIDQETNEQMKLAEDQSRLDLKQQLESLERRAHDRRRVALDLLLSKLTAR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.