Basic Information | |
---|---|
Taxon OID | 3300002072 Open in IMG/M |
Scaffold ID | JGIcombinedJ21914_10040974 Open in IMG/M |
Source Dataset Name | Barrow Graham LP Ref core NGADG0011-211 (Barrow Graham LP Ref core NGADG0011-211,NGADG0004-312, ASSEMBLY_DATE=20131005) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1659 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Barrow, Alaska, USA | |||||||
Coordinates | Lat. (o) | 71.290565 | Long. (o) | -156.788622 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F096250 | Metagenome | 105 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGIcombinedJ21914_100409742 | F096250 | AGGAGG | MRVGMAAWLICSTICFLSLVNGELAMSAYFLALSCVLPGYVAKELQRPRT* |
⦗Top⦘ |