Scaffold JGI24808J26613_1013445

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI24808J26613_1013445

Scaffold JGI24808J26613_1013445

Overview

Basic Information
Taxon OID	3300002099 Open in IMG/M
Scaffold ID	JGI24808J26613_1013445 Open in IMG/M
Source Dataset Name	Soil microbial communities from Manhattan, Kansas, USA - Sample 400um MDA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1477
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Kansas (Konza Prairie Natural Area And Manhattan, Kansas, Usa)

Source Dataset Sampling Location
Location Name	Manhattan, Kansas, USA
Coordinates	Lat. (^o)	39.214	Long. (^o)	-96.5852	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000621	Metagenome	981	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24808J26613_10134452	F000621	AGGAGG	VPTTKHELLDWLMDVPEDAEIGTDGDGLALLAIRGTNVHLLEVGRIPNADELYAEAINEAMMERLRRIDAAGGETETGIIIVTLQGYISGIPRLFSTDFNTAFIFNREQAEAFITEFADELYNPQILDYR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.