NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold M2t6BS2_1144924

Scaffold M2t6BS2_1144924


Overview

Basic Information
Taxon OID3300002132 Open in IMG/M
Scaffold IDM2t6BS2_1144924 Open in IMG/M
Source Dataset NameMarine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t6BS2 (105f)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9070
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (27.27%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea, Analyzing Arctic Terrigenous Carbon Compounds

Source Dataset Sampling Location
Location NameBaltic Sea
CoordinatesLat. (o)57.305Long. (o)20.0745Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F057337Metagenome / Metatranscriptome136N
F087783Metagenome / Metatranscriptome110N

Sequences

Protein IDFamilyRBSSequence
M2t6BS2_11449244F057337N/AMNYSELNKMTVADLRNLNKMVVETLRSKRKLESMTMKSELHIGAIVSVDHPKMAGHELKITKINRAKAICELINGKGSYNVPLSMITLIN*
M2t6BS2_11449245F087783N/AMLQIGFSTKYFTLWDVRNETEYSGSEGQYSYNVTKFTYIQNLSLVEEKAIAKAKEKGCTQLGINDELRGRSGRSFEKRTPIEKVFELHQFTYGKYEGDDIRENTDISYLTWYFSQTELMLVAERICELDSDYSIYKDILVTSEQLANITKIDTIEAGLKKTGTIQLQMVRNLDSYGFVQIDGINYHFGEHSIMSYNGHDYGLPILGCKAKRVKNKLIEVKVEFGSVGDWKAWKVTDWDFVK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.