NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold M2t6FKB2_1165681

Scaffold M2t6FKB2_1165681


Overview

Basic Information
Taxon OID3300002134 Open in IMG/M
Scaffold IDM2t6FKB2_1165681 Open in IMG/M
Source Dataset NameMarine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t6FKB2 (101f)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2311
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (88.89%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea, Analyzing Arctic Terrigenous Carbon Compounds

Source Dataset Sampling Location
Location NameBaltic Sea
CoordinatesLat. (o)57.305Long. (o)20.0745Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031468Metagenome / Metatranscriptome182Y
F033361Metagenome / Metatranscriptome177Y

Sequences

Protein IDFamilyRBSSequence
M2t6FKB2_11656812F031468GAGMKITIEVDGADAEELVALVQRAAEAVEKLEAILKEFEDAD*
M2t6FKB2_11656813F033361AGGAMLIECNAIDHAYLIEDDPVRPKLFKDNSVRFEGPFRVYAEVNDETGEIAAVVCVIVCKFVPQDEYQIKLIAMGKTEQIEEQLKEREEMHGELGTILCPYSVWSYQKGHGRKLINNLLEAAPILHPEIDAVITMSPHTDTAMRFHISNGADIFSTNSKCVNYEYEVPDVILH*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.