Basic Information | |
---|---|
Taxon OID | 3300002134 Open in IMG/M |
Scaffold ID | M2t6FKB2_1592203 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t6FKB2 (101f) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 16055 |
Total Scaffold Genes | 20 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (5.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea, Analyzing Arctic Terrigenous Carbon Compounds |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Baltic Sea | |||||||
Coordinates | Lat. (o) | 57.305 | Long. (o) | 20.0745 | Alt. (m) | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F068524 | Metagenome | 124 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
M2t6FKB2_15922031 | F068524 | N/A | MSMNTNTNTIANIELSESENEFLRFRHEVTRSRIIKYIENGLPFDKAVIKEAGESLISYYEYIRNNIKDEDKHKLNEFDDIPLTYHGTDLNDFEKDIFDRLPNIGKWQWGNYTRVWRALEEADEC |
⦗Top⦘ |