Scaffold M2t6FKB1_1675882

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold M2t6FKB1_1675882

Scaffold M2t6FKB1_1675882

Overview

Basic Information
Taxon OID	3300002136 Open in IMG/M
Scaffold ID	M2t6FKB1_1675882 Open in IMG/M
Source Dataset Name	M2t6FKB1 (104f)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	12565
Total Scaffold Genes	22 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (27.27%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → Porticoccus → unclassified Porticoccus → Porticoccus sp.	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea, Analyzing Arctic Terrigenous Carbon Compounds

Source Dataset Sampling Location
Location Name	Baltic Sea
Coordinates	Lat. (^o)	57.305	Long. (^o)	20.0745	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068524	Metagenome	124	Y

Sequences

Protein ID	Family	RBS	Sequence
M2t6FKB1_167588222	F068524	N/A	ANIELSESENEFLRFRHEVTRSRIIKYIENGLPFDKAVIKEAGESLISYYEYIRNNIKDEDKHKLNEFDDIPLTYHGTDLNDFEKDIFDRLPNIGKWQWSNYTRVWRALEEADECLMEFVYHEANYLCQAPQDSN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.