NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24710J26742_10081189

Scaffold JGI24710J26742_10081189


Overview

Basic Information
Taxon OID3300002174 Open in IMG/M
Scaffold IDJGI24710J26742_10081189 Open in IMG/M
Source Dataset NameBiogas fermentation microbial communities from Germany - Plant 2 DNA2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1214
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion → Biogas Fermentation Microbial Communities From Biogas Plants In Germany

Source Dataset Sampling Location
Location NameBielefeld, North Rhine-Westphalia, Germany
CoordinatesLat. (o)52.0385Long. (o)8.4956Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F091648Metagenome / Metatranscriptome107Y
F099496Metagenome / Metatranscriptome103Y

Sequences

Protein IDFamilyRBSSequence
JGI24710J26742_100811892F099496AGGAGMEQVIKEQVKKECNKICGCIYEESNESIRVYPYNHIITSRLIVAIDMIKEEYAGMVDYYIGYDGLRREIYVSVGDS*
JGI24710J26742_100811894F091648AGGMTENENKPELSXLETVERNLKAALNAWTDEINVSELPKALQRKHRVVNEKTAALMYDVHQYLITKRRVGRPAGGITKTTVRNELKNATPEQLAAIAKILGKEDEVPPLSADMENVEEVNDNE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.