Basic Information | |
---|---|
Taxon OID | 3300002230 Open in IMG/M |
Scaffold ID | M1t2FKB2103N_1438826 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Baltic Sea - M1t2 FKB2 (103N) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Karolinska Institutet |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 11597 |
Total Scaffold Genes | 26 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 25 (96.15%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea Examining Degradability Of Arctic, Terrigenous Carbon Compounds In The Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Baltic Sea | |||||||
Coordinates | Lat. (o) | 58.133 | Long. (o) | 10.0 | Alt. (m) | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F030605 | Metagenome / Metatranscriptome | 185 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
M1t2FKB2103N_143882619 | F030605 | AGG | MNMERYYAQLVGCKIVDFKFEQDEDAYAGDLPFPVFTIERDDGVRVILTLSMDEEGNGGGFGFIEGAE* |
⦗Top⦘ |