NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold B570J29579_101063

Scaffold B570J29579_101063


Overview

Basic Information
Taxon OID3300002272 Open in IMG/M
Scaffold IDB570J29579_101063 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1586
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000325Metagenome / Metatranscriptome1296Y
F040587Metagenome161Y

Sequences

Protein IDFamilyRBSSequence
B570J29579_1010631F000325N/AHKMKTADGNDKLGKGCIVVSRPVGDTCPSXCDYLNNGCYAEATENQYKNARVAGFANVVTEKHKIRAMILDAKKRKKSIRWHERGDWFLNGELDLDYVANVTWACESILADGDSLPDMWFYTHIYDSRLVSLEKYMNVYASVHDDNDMGEALAQGFKLFAWCDSDMKIAPKRPKSKVKAEAWRKALPKLVVLNGSKFVTCPEIRRGRSEITCTGTKDSISCDLCVRGLANVLFPAH*
B570J29579_1010634F040587AGGAMLQWIGVIVAILGFAYNGVKDYQKGEIKLPALQQKQELTKTNHPIQYCLMAYDPNLNKVFYQHENGQWYDYAPQQRRYATTPQVRHY*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.