Basic Information | |
---|---|
Taxon OID | 3300002308 Open in IMG/M |
Scaffold ID | JGI20171J29575_11714211 Open in IMG/M |
Source Dataset Name | Nasutitermes corniger P4 segment gut microbial community from laboratory colony in Florida, USA - Nc150 P4 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 562 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | laboratory colony in Florida, USA | |||||||
Coordinates | Lat. (o) | 26.0625 | Long. (o) | -80.2332 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000026 | Metagenome | 5546 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI20171J29575_117142112 | F000026 | AGAAG | MHMVQSSFYLTIALHVSGIIVTHLQEHKTTVTTASGNRYTV |
⦗Top⦘ |