NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI20171J29575_11903574

Scaffold JGI20171J29575_11903574


Overview

Basic Information
Taxon OID3300002308 Open in IMG/M
Scaffold IDJGI20171J29575_11903574 Open in IMG/M
Source Dataset NameNasutitermes corniger P4 segment gut microbial community from laboratory colony in Florida, USA - Nc150 P4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)658
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location
Location Namelaboratory colony in Florida, USA
CoordinatesLat. (o)26.0625Long. (o)-80.2332Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F064188Metagenome129Y

Sequences

Protein IDFamilyRBSSequence
JGI20171J29575_119035741F064188N/AMHLDTIQSFIYPTDAQLDCSKNAKIYITIYMRGAATCFGFSQPSSGSYYMCFAKVISINNQLK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.