NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold B570J29625_1000570

Scaffold B570J29625_1000570


Overview

Basic Information
Taxon OID3300002400 Open in IMG/M
Scaffold IDB570J29625_1000570 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3565
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018650Metagenome / Metatranscriptome234N

Sequences

Protein IDFamilyRBSSequence
B570J29625_10005704F018650N/ALAKXYTDWWTFKPSSPLKAYLSDHEIVMXEYFSLEELRCQVMSIIRHRAQLSNHNVIVLEDQELQMVFDSWYIFVPDVENHLLAHVIPAPADISNDLQNKHMTEEFYINSPVDLLYKDPSSVFWILPFVDFAMNQSTGNVRSWKKLLXMFTKFCLNNTTYFTRVSDSIIRINENTCLTSLFGFKYFHRSQIEHLLKKITKFLGRKNSMVQSCHFIKHNPVFNKTTKHXNVFAFIDDIINKNNDMMPDFQTGLYI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.