NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24188J35168_1012602

Scaffold JGI24188J35168_1012602


Overview

Basic Information
Taxon OID3300002492 Open in IMG/M
Scaffold IDJGI24188J35168_1012602 Open in IMG/M
Source Dataset NameAnoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant NP 2012
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2749
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.534Long. (o)-110.7978Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012577Metagenome / Metatranscriptome279Y

Sequences

Protein IDFamilyRBSSequence
JGI24188J35168_10126021F012577AGGAGGMLVAITRPHQHFPVPLTAADYEFTTSDDGDERGRVTLPPALARSGVMTQIGDELAVYCTQLSKTIWRGQIERIEEPTDGSITWHALGFGALQRDARISVVQNMSDMSRWRPVGSGFIPLSAGYDSRPDLWEYEIVSVGGLAQMRIRTKKAFTITTYDLLFLAYLYDQPERYFRIRAYENIRVTSIAYTNLAVGVLIAPITAVPQPDAYTFTLGAFTLQPAPGTVIETNCYGWIVGVLAPGNETTAGATSVTFHVTVNNTSAYSGHAIDEGLLTSALIGRGGCCDIYIPAGTNANITKPDANLREIIEQSTDEYAQVRYPRKRFLRDRALPTIDFRADSPLVWRFPETTRVVDISKAPNRVYGQYRGYWTDHLTATTMILPLESRRQSLAWRVASVGEYGSKAIAETRRDEAAVAFDRQIAPITVELDNARYELMTRDGITVPNWAADVSDYAIVPGY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.