NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24130J36418_10016108

Scaffold JGI24130J36418_10016108


Overview

Basic Information
Taxon OID3300002549 Open in IMG/M
Scaffold IDJGI24130J36418_10016108 Open in IMG/M
Source Dataset NameArctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2334
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location
Location NameBarrow Environmental Observatory site, Barrow, Alaska, USA
CoordinatesLat. (o)71.29055Long. (o)-156.788643Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F106196Metagenome100N

Sequences

Protein IDFamilyRBSSequence
JGI24130J36418_100161083F106196AGGTGGMTEDDKNETIKCTISCPECGAEMVCTHEDPKHEDKHRCAKGHEWA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.