NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI25384J37096_10028490

Scaffold JGI25384J37096_10028490


Overview

Basic Information
Taxon OID3300002561 Open in IMG/M
Scaffold IDJGI25384J37096_10028490 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2177
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameAngelo Coastal Reserve, California, USA
CoordinatesLat. (o)39.718176Long. (o)-123.652732Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002331Metagenome / Metatranscriptome569Y
F047850Metagenome / Metatranscriptome149Y

Sequences

Protein IDFamilyRBSSequence
JGI25384J37096_100284901F047850AGGAGVIRFLVTRGSVLVLALVLSGCALTLDSTHLGVPVSLAGAAQRPDSGIPFRVTKHAVYMLLGLVQVAQPNLEDVLAAQVGTGTRI
JGI25384J37096_100284903F002331GAGGMKRAALTLGLTALLATPAWAQWLGEPLWNSPKGGTGVTISGDYARPNSDYGKGNTWGGRASLGIGTLTFTAGVARWKPDAATEGFTSIGGNAAFRLIGGSLLPFSLNLQVGAARTDSANSTPAQTAVTGATGFSVPLPTPGISIEPYFSPGIRYRRSGGVNSTQFGYVFGANLSFGLVGVHLAYDNEKLKGGGSRRVFGVGAHVDFHLPLGM*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.