Scaffold JGI25382J37095_10043438

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI25382J37095_10043438

Scaffold JGI25382J37095_10043438

Overview

Basic Information
Taxon OID	3300002562 Open in IMG/M
Scaffold ID	JGI25382J37095_10043438 Open in IMG/M
Source Dataset Name	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1746
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location Name	Angelo Coastal Reserve, California, USA
Coordinates	Lat. (^o)	39.718176	Long. (^o)	-123.652732	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018818	Metagenome / Metatranscriptome	233	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI25382J37095_100434382	F018818	AGGCGG	VSKRNFFVIASLAGAGLVLLTIFITGAAAFKGRRSETSKSWNQEAIKATYVATQLKETDKAHSTLTLSYDLENNTDSDYHLDAGPGVVILSRLKADGSLSQQEPLRLSYPVFLPAKQHARLSIEMTQPFAWPIEEDPAYVEKLREFVKQRLASVGEFALFDQASRAEVRLPGAWQELQEAARASY*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.