NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI25382J37095_10055528

Scaffold JGI25382J37095_10055528


Overview

Basic Information
Taxon OID3300002562 Open in IMG/M
Scaffold IDJGI25382J37095_10055528 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1513
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameAngelo Coastal Reserve, California, USA
CoordinatesLat. (o)39.718176Long. (o)-123.652732Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007967Metagenome / Metatranscriptome341N
F022851Metagenome / Metatranscriptome212N

Sequences

Protein IDFamilyRBSSequence
JGI25382J37095_100555281F007967AGGGGGVVSTEIVGLGLIGFSVNCLMVVFNTIGIEKKDTDKLGGGWGLAHLSLGAMMVLVGVATFMNDPVGGLTSTPATAAISGFFGIALVFYGFFWVFLGASLVRGADLRPVGQVSIGFAIVDLWFLNSAMKFSAGAGGKYLSLIILLVVLTVVFFVLYAGVHGKAVAFKVNAVLLIILALL
JGI25382J37095_100555282F022851GAGGVRIRIGVLVALSLAAATLPGPGVAANGTGSGILTGQGSFVLTPTGSLNYTLHAYLADMGFPMRQGDTLVYSWSVNNGSGPPVYFEIHGHPPGRYDVFFNTTSSSVSGAWTAPVQEPYMVYWRNDQTVRVNVTFAFNLVQAQSDVWPLYLTPLGVALVALAGVFLKFRERRTRPPE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.