NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI25136J39404_1000350

Scaffold JGI25136J39404_1000350


Overview

Basic Information
Taxon OID3300002760 Open in IMG/M
Scaffold IDJGI25136J39404_1000350 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - ETNP_6_1000
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7365
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (58.82%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)18.92Long. (o)-104.89Alt. (m)Depth (m)1000
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000747Metagenome / Metatranscriptome908Y
F000929Metagenome / Metatranscriptome830Y
F034956Metagenome / Metatranscriptome173Y

Sequences

Protein IDFamilyRBSSequence
JGI25136J39404_10003501F000747N/AVLLLLLPLAASARIFPTEFPVKAVCFDNADEAISYHQDILGEYPIGKGWVSEHTFGAIMYNPVKPSWTFLSFHKNDNGVIVCAITGGTHWETIDLGNEGGKLQX*
JGI25136J39404_10003502F000929GGTGGMSNGNQLGKSLSVGHIVATVGXIIGGFTFIYDLRESVAIQTFQLESVEKRLERVVARTDDQFGEIMDHLVRLEEKLDAMVLPNPVYQKAR*
JGI25136J39404_10003503F034956N/AMKCTHLQIVKESYGSHLRFTLQLCFDFLLLAIVSIVHGLCPWILTAKVSDRVKELNAILNERWLNPK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.