Scaffold s1d14p1_10226845

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold s1d14p1_10226845

Scaffold s1d14p1_10226845

Overview

Basic Information
Taxon OID	3300002780 Open in IMG/M
Scaffold ID	s1d14p1_10226845 Open in IMG/M
Source Dataset Name	Piglet fecal microbial communities from UC Davis, California, USA, of a weaning piglet - sample 1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3359
Total Scaffold Genes	8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Piglet Fecal → Piglet Fecal Microbial Communities From Uc Davis, California, Usa, Of A Weaning Piglet

Source Dataset Sampling Location
Location Name	University of California, Davis, USA
Coordinates	Lat. (^o)	38.53	Long. (^o)	-121.76	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099451	Metagenome	103	N

Sequences

Protein ID	Family	RBS	Sequence
s1d14p1_102268456	F099451	AGGAG	MEIKNVGQLRKIIENLSDDYEIEMRVRRKLSDEELKECRYPYPYDTEYLTLEFDDIGVSDKVLCLGVTSKIN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.