Scaffold BMAI_1006642

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold BMAI_1006642

Scaffold BMAI_1006642

Overview

Basic Information
Taxon OID	3300002822 Open in IMG/M
Scaffold ID	BMAI_1006642 Open in IMG/M
Source Dataset Name	Illumina_Fosmid_Bertioga
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2236
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Mangrove Soil → Mangrove Soil Microbial Communities From Bertioga, Brazil, Sampling Enzymes

Source Dataset Sampling Location
Location Name	South America Atlantic Tropical Mangrove
Coordinates	Lat. (^o)	-23.89694	Long. (^o)	-46.20778	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F095691	Metagenome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
BMAI_10066421	F095691	N/A	MLQHDGTIRIAWHADGFEAIVVRARFRPSSEVEGFAKDVADLALLERTLPDLRSALRKRFPGRFELITDEPVSEPGRVIISFHPPPGEPNPDPW*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.