NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BMAI_1064620

Scaffold BMAI_1064620


Overview

Basic Information
Taxon OID3300002822 Open in IMG/M
Scaffold IDBMAI_1064620 Open in IMG/M
Source Dataset NameIllumina_Fosmid_Bertioga
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)872
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Mangrove Soil → Mangrove Soil Microbial Communities From Bertioga, Brazil, Sampling Enzymes

Source Dataset Sampling Location
Location NameSouth America Atlantic Tropical Mangrove
CoordinatesLat. (o)-23.89694Long. (o)-46.20778Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074893Metagenome / Metatranscriptome119Y

Sequences

Protein IDFamilyRBSSequence
BMAI_10646201F074893AGGAGGMMASNGLQATANNGALTIRITGPMDLLLTSALREFCHETGAVYRRYIIDLQDVSIVRDSGLALLLMLKRLASRTGATLDVIN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.