NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold B570J40625_100551266

Scaffold B570J40625_100551266


Overview

Basic Information
Taxon OID3300002835 Open in IMG/M
Scaffold IDB570J40625_100551266 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1068
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.099444Long. (o)-89.404444Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F060658Metagenome / Metatranscriptome132Y
F097235Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
B570J40625_1005512661F097235AGGAMYGQMMGKRKMDGMGRMEPEVETVEFTPPKELRLEGDSGTAMVDWRTTARGTIEIIGFDGITLGESGRQDVEEMEGA
B570J40625_1005512662F060658N/ARLVLPYRNVVATQGIRSEFNPDYNNAQYQISYINNPRALRVLPFRPEAVNPNMPFLVRDYGGRWKFATNDLGADCAGKPIDNSRGNKGKFIADFQLAVKPEHPEWLEAIFHKVQGACPVIVTGCAADPGDSEQNYNSADPVCPRVIQFTAVADDATNYVIGTTGIMCDDNIVTNAGISVATVALLVTALQARWDTEFGAGAATWSVVSGNLIQVSGTICNSVTLEFSI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.