NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0006761J43178_102119

Scaffold Ga0006761J43178_102119


Overview

Basic Information
Taxon OID3300002865 Open in IMG/M
Scaffold IDGa0006761J43178_102119 Open in IMG/M
Source Dataset NameAvena fatua rhizosphere microbial communities - H1_Bulk_Litter_4 (Metagenome Metatranscriptome, Counting Only)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)625
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere → Avena Fatua Rhizosphere Microbial Communities From Hopland, California, Usa, For Root-Enhanced Decomposition Of Organic Matter Studies

Source Dataset Sampling Location
Location NameHopland, California, USA
CoordinatesLat. (o)38.97364Long. (o)-123.117453Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018876Metagenome / Metatranscriptome232Y

Sequences

Protein IDFamilyRBSSequence
Ga0006761J43178_1021191F018876GGCGGVPSARLSFGLPASFGSFVPTLDAWTKSPLSVECRLSSQAGEVTLRFRSAVLSSTEAVDAFAPLPLPVTSPVELRLASSFVRISFFGLAGDRFPFPLNAVAPAQPATKLLLLPNFASP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.