NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI25613J43889_10012369

Scaffold JGI25613J43889_10012369


Overview

Basic Information
Taxon OID3300002907 Open in IMG/M
Scaffold IDJGI25613J43889_10012369 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2370
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameLaytonville, California, USA
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005917Metagenome / Metatranscriptome386Y
F013799Metagenome / Metatranscriptome268Y

Sequences

Protein IDFamilyRBSSequence
JGI25613J43889_100123691F013799GGAGLKDLLADWKLLLAMGGAAIAGLALVAYAFFRPAANPEEVERKRRLHLNQIGRIAEGQIVELVEHPPESEKASKGLFGAGARPLRDMRPRHLVSYSYLISGVT
JGI25613J43889_100123693F005917GAGMQVRPHLPGYRWFHVFRNAAIRTGVYVGVCLTLVFTTWLVIANHAPFLERFALERNIAAAVILCFLAAVPIFRFLRLPGHLLASGLLGWLIFSLSYRALCLIYHGLSYRLSTFHVFMLGAVVYMILTTLCWIVVTIWRAREANASHPKHHAS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.