Basic Information | |
---|---|
Taxon OID | 3300002919 Open in IMG/M |
Scaffold ID | JGI26061J44794_1096732 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Bottom_A/KNORR_S2/LV |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 508 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Affecting The Dissolved Organic Carbon Pool |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South Atlantic Ocean | |||||||
Coordinates | Lat. (o) | -37.9728 | Long. (o) | -44.9905 | Alt. (m) | Depth (m) | 5110 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F016878 | Metagenome | 244 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI26061J44794_10967321 | F016878 | N/A | WTESLSTMLFDLPRAGLKDLKIPLSSSIMNRVWPKSVRSKAFHVTDLDGVFKLTKMGKTKSISAFYNIEDIMISSGIKTNGGYVVELEGDVLAASPDDISSQPDKSGRRWITFSSLMNSSTDADPGLGGKTQLRGIDTDLENLLVKILEKNKNEKWQEYKDVGGAAII |
⦗Top⦘ |