NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Pfga_1046276

Scaffold Pfga_1046276


Overview

Basic Information
Taxon OID3300002920 Open in IMG/M
Scaffold IDPfga_1046276 Open in IMG/M
Source Dataset NameHot springs microbial communities from Mammoth Hot Springs, Yellowstone National Park, Wyoming, USA-MHS Pond Facies_Gas lift
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Illinois, Urbana-Champaign
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1463
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Thermus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Springs → Hot Springs Microbial Communities From Mammoth Hot Springs, Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location NameYellowstone Mammoth Hotsprings
CoordinatesLat. (o)44.9766Long. (o)-110.7016Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F035590Metagenome / Metatranscriptome171N
F049435Metagenome / Metatranscriptome146Y

Sequences

Protein IDFamilyRBSSequence
Pfga_10462762F049435N/AMFRCFINLLPASRAQSEIVFYARTQPFIITKLALRIYLGFIADDSSPTYVENVKALMRAQEGRIMSAQNTKLFTDPILIYDVFAVNTPDGVQLDGFFDLSFYAGQASELQNCFNKISNDLEETRKVLSKYASPNLSAISVSAYISDLNQIYQSLEKSLKPIVESGALKLSATAAEYIHNFILQLFYRDVREIVYEVWDVNTLVVADSSNQYFDVFNTWDDEAEQRGWEFPAFDNQP*
Pfga_10462763F035590N/AMMSMNKKKLILEQLERLIEHHPCNGRDFFYLSLDGIVTLSFSVDNNGIVTLEQASVDGQFAIDLNRI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.