 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300002925 Open in IMG/M |
| Scaffold ID | Pfgo_1045787 Open in IMG/M |
| Source Dataset Name | Hot springs facies microbial communities from Mammoth Hot Springs, Yellowstone National Park, Wyoming, USA - MHS-Pond Facies_GO |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Illinois, Urbana-Champaign |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5894 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Springs Facies → Hot Springs Facies Microbial Communities From Mammoth Hot Springs, Yellowstone National Park, Wyoming, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Yellowstone National Park, USA | |||||||
| Coordinates | Lat. (o) | 44.9766 | Long. (o) | -110.7016 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007033 | Metagenome / Metatranscriptome | 359 | Y |
| F068874 | Metagenome / Metatranscriptome | 124 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Pfgo_10457873 | F068874 | N/A | VFGRLRRVLRFHERVSLPDVPAQAQALSYSGRTIVSYPPSPAWAVREPLWLGRRGLGYYAPSTAKRKRRLGLPDREIVLFQTGKLYASIQVVNMKKYYLIRVERDKLAAIIRRFPVKRWLRVDAYAVRAGLGKALLAALLGCASLRKQRVIQSGEVAVRREEVVSHETLRLTTLLNDTVHLRNERLVIHYDTIHQSLRIEQVRPVVVVRDSVVRWNAMVQAPTWVAGAGEERRESWWRRWGRGALALMLGLGFLAFIGYLWLRALRIG* |
| Pfgo_10457874 | F007033 | N/A | RRIAFETELFASNQPADFNLFSTSVYTDALRLMTPILYNVESERPESVFEELSGTKFFVRHQPRTFKALVAKPPTEWGINIEQFRCLSRLGVFLIDDAGVVWGRRNKPDSAAPIPIEPGTVQVRLLFPSDSAITKYEFSFDFAQSLMDFELVPVFADSQLLSYTPPIATRLDAEWNSPGLLAYIYALYARGAGNLYIPITGLASHLEVRDNANTLITASFTETAPGKYIANFTPPPPTTGNPYTVKIGSSAPPSAFDYTTAVAQFNV* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |