Basic Information | |
---|---|
Taxon OID | 3300003073 Open in IMG/M |
Scaffold ID | Ga0052263_10085 Open in IMG/M |
Source Dataset Name | Marine surface microbial communities Puget Sound, Washington, USA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Washington |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 592 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From Surface Seawater At Puget Sound |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Beach at Golden Gardens Park, Seattle, WA, USA | |||||||
Coordinates | Lat. (o) | 47.6906558 | Long. (o) | -122.404411 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F032291 | Metagenome / Metatranscriptome | 180 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0052263_100852 | F032291 | AGG | VTAVGVPLIAPVEASKDKPAGSDGEIDQLVIVPPFTVGVAVVMAVPLVKLNVLGLYVRDEGATSFTTIVTVTVSLPPVL |
⦗Top⦘ |