Basic Information | |
---|---|
Taxon OID | 3300003099 Open in IMG/M |
Scaffold ID | Ga0052239_102175 Open in IMG/M |
Source Dataset Name | Fresh water viral communities from Lake Needwood, Maryland, USA - June 2007 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 910 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Fresh Water → Fresh Water Viral Communities From Lake Needwood, Md |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lake Needwood, Maryland, USA | |||||||
Coordinates | Lat. (o) | 39.121 | Long. (o) | -77.129 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F010464 | Metagenome / Metatranscriptome | 303 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0052239_1021751 | F010464 | N/A | MSAGGVVAWFTKGRFESESLQVKQAQAVLAMWQATAEAQNKELVELRNEVVSLRQRLEEMEHTIHELQSENAQLKNLS* |
⦗Top⦘ |