 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300003155 Open in IMG/M |
| Scaffold ID | Ga0052270_10308069 Open in IMG/M |
| Source Dataset Name | Broiler Chicken cecum microbial communities from the University of Birmingham, UK |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Birmingham |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3072 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium UC5.1-2G11 | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Birds → Digestive System → Ceca → Lumen → Broiler Chicken Cecum → Broiler Chicken Cecum Microbial Communities From The University Of Warwick, United Kingdom |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | University of Birmingham, UK | |||||||
| Coordinates | Lat. (o) | 50.9047 | Long. (o) | -3.5233 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051936 | Metagenome | 143 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0052270_103080694 | F051936 | N/A | MKQEGTGLCPVLPLALRGKAFGFSVLQEHAVMTLVISIFFATLIIRYLSIHISIKK* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |