Scaffold Ga0006778J45830_1031922

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0006778J45830_1031922

Scaffold Ga0006778J45830_1031922

Overview

Basic Information
Taxon OID	3300003162 Open in IMG/M
Scaffold ID	Ga0006778J45830_1031922 Open in IMG/M
Source Dataset Name	Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4565
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Leviviricetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere → Avena Fatua Rhizosphere Microbial Communities From Hopland, California, Usa, For Root-Enhanced Decomposition Of Organic Matter Studies

Source Dataset Sampling Location
Location Name	Hopland, California, USA
Coordinates	Lat. (^o)	38.97364	Long. (^o)	-123.117453	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018726	Metagenome / Metatranscriptome	233	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0006778J45830_10319222	F018726	AGGAG	MLPDPVTITAASPTPQLVFAVVKQDGYGSERKDTGGNGYTVITNHSYQKGGGDKHYVQMTQTLNATDPYSGLTKKQTASVSITIVRPAFGFTDAAMIALAKALTDYRDDSEVTTAKLLQFQS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.