NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold IrcVar142_1001803

Scaffold IrcVar142_1001803


Overview

Basic Information
Taxon OID3300003251 Open in IMG/M
Scaffold IDIrcVar142_1001803 Open in IMG/M
Source Dataset NameIrcinia variabilis associated microbial communities from Achziv, Israel - Sample 142
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7313
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (20.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Ircinia Variabilis Associated → Ircinia Variabilis Associated Microbial Communities From Achziv, Israel

Source Dataset Sampling Location
Location NameAchziv, Israel
CoordinatesLat. (o)33.01Long. (o)35.04Alt. (m)Depth (m)5 to 9
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F045799Metagenome / Metatranscriptome152N

Sequences

Protein IDFamilyRBSSequence
IrcVar142_10018032F045799N/AMKKLFLALLFNLITLTAFSQDNFAGWWESKTSKYITMIYVGDYGVSQVVNYNPWNEDVIEERIIRRNKYTFVTHLFNKRNGYSVKIKYKLKDKNNLICKFTGDLKRTVHLTRYKFDLNNKLKT*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.