NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI25908J49247_10013272

Scaffold JGI25908J49247_10013272


Overview

Basic Information
Taxon OID3300003277 Open in IMG/M
Scaffold IDJGI25908J49247_10013272 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2535
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (88.89%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F035768Metagenome / Metatranscriptome171Y
F039639Metagenome / Metatranscriptome163Y
F061859Metagenome / Metatranscriptome131Y
F062765Metagenome / Metatranscriptome130Y

Sequences

Protein IDFamilyRBSSequence
JGI25908J49247_100132723F062765GGAMEWYRARGLTQKQTKTATQDTMFYNTGDTYTTEDITTNYSCGRIDIRGIPNEPYGDELGVPPMLSSDWHAFGNWLWDIQTISVWTLADLITAYEQHNPKITWDTHDR*
JGI25908J49247_100132725F035768AGGAMKITIEDRLLAAYTAQRLRLRDREDEDYRARVEVKAFERIILDRVHRNLRLGLDKGTNVDLEV*
JGI25908J49247_100132726F061859GGAMTIEITLIILGLCLAVCYVVLEYQKLAKPPYQEPVKPDMAEQWKAATKADTLDNIDNWNAKVGDKIWWKQPEETLEPTVLNPQAAWPFPHTKP*
JGI25908J49247_100132728F039639AGGAGMNIDREFVKWFYEAEYPEQGSNRRQVYSTTQNSQNINVIDYWMREAFKAGAQAATNSYEVNALEQFEAFNINRNYPL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.