Scaffold Ga0006242J48907_101254

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0006242J48907_101254

Scaffold Ga0006242J48907_101254

Overview

Basic Information
Taxon OID	3300003292 Open in IMG/M
Scaffold ID	Ga0006242J48907_101254 Open in IMG/M
Source Dataset Name	Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome C0912_C27A4_80 (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	892
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location Name	Monterey Bay, California, USA
Coordinates	Lat. (^o)	35.7899	Long. (^o)	-122.3199	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000287	Metatranscriptome	1370	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0006242J48907_1012541	F000287	GGAGG	MKVYDTNQEFGGNYYQPMIQYINHKDIYGPFAKKADVYLPHRAEVTSAKFTNMRYNDKSSAKHNLDQFLVDAHQTQIKELNGTTAMARVNLMKNIVTSRRQPHSPLDNVNTPYNPIRLLKGAPPGQEAVNHWISELSIVKGSNHKLETKHRQHLAMIDACEDEYDYHHKLFGQGAVDRDMKFFNPQLTADYVNQIRRV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.