Scaffold Ga0006770J48903_1013003

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0006770J48903_1013003

Scaffold Ga0006770J48903_1013003

Overview

Basic Information
Taxon OID	3300003305 Open in IMG/M
Scaffold ID	Ga0006770J48903_1013003 Open in IMG/M
Source Dataset Name	Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	597
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Tardigrada → Eutardigrada → Parachela → Hypsibioidea → Hypsibiidae → Hypsibius → Hypsibius dujardini	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere → Avena Fatua Rhizosphere Microbial Communities From Hopland, California, Usa, For Root-Enhanced Decomposition Of Organic Matter Studies

Source Dataset Sampling Location
Location Name	Hopland, California, USA
Coordinates	Lat. (^o)	38.97364	Long. (^o)	-123.117453	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046789	Metagenome / Metatranscriptome	150	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0006770J48903_10130031	F046789	N/A	MATSTIILLALVMVGCSMAQDPSSILEWAKLLKTANDLGMSMLSDDKDMNIMSYPCHWSRKAGWYRWKLNYDGKIACKTIGQEYSHNHCESKGCAWKEPFMLLIKDFIINNRAPKDGLVAAIQASDLSAQEKQDLLKLAGAGR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.