Scaffold Ga0006883J46559_1042081

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0006883J46559_1042081

Scaffold Ga0006883J46559_1042081

Overview

Basic Information
Taxon OID	3300003307 Open in IMG/M
Scaffold ID	Ga0006883J46559_1042081 Open in IMG/M
Source Dataset Name	Hypersaline microbial mat communities from Elkhorn Slough, Monterey Bay, California, USA - CR8A/B (Metagenome Metatranscriptome, Counting Only)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	824
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location Name	Elkhorn Slough, Monterey Bay, California, USA
Coordinates	Lat. (^o)	36.7999	Long. (^o)	-121.7999	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015563	Metagenome / Metatranscriptome	253	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0006883J46559_10420811	F015563	N/A	MSTTSLRTARSATSKVSNKAAFWGQWGANNPKHAETFLKQAYNRGYGQPLITGRYIEYDNTPTFLTFLARRWRYDWLKHIAMRVDAQRTPLVVLRRQIWMARFEYWARRWYARKAINRAAKVEWAFIKAKLEQPFTWTGHDLLHGLFWSMNMFAFFAIGEIFCRDRINGYGVATPEWTPAKPKFAPGFYHVYDPFESYPFDNQTNFITKQFQRTSWWNNSMETYWAPHRILA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.