Basic Information | |
---|---|
Taxon OID | 3300003307 Open in IMG/M |
Scaffold ID | Ga0006883J46559_1122268 Open in IMG/M |
Source Dataset Name | Hypersaline microbial mat communities from Elkhorn Slough, Monterey Bay, California, USA - CR8A/B (Metagenome Metatranscriptome, Counting Only) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 500 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Zoopagomycota → Entomophthoromycotina → Entomophthoromycetes → Entomophthorales → Ancylistaceae → Conidiobolus → Conidiobolus coronatus → Conidiobolus coronatus NRRL 28638 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Elkhorn Slough, Monterey Bay, California, USA | |||||||
Coordinates | Lat. (o) | 36.7999 | Long. (o) | -121.7999 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004248 | Metagenome / Metatranscriptome | 446 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0006883J46559_11222681 | F004248 | N/A | GTSDTYHEDKILNKYLSLDSEGKELVYKAAVQLAIIGYGSKNYGFVRKNEDEIVNLTDIFKKYGIKYLEKLNSKYNEDDLSVRRLLRLFRYQISRFIIENQRPSYLWLKYSNKNKNFIHICFPGGEHMVENKEEAEYLISTYSNLDVQLGTKFRDRLRRVFIARNI |
⦗Top⦘ |