Scaffold D1draft_1000635

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold D1draft_1000635

Scaffold D1draft_1000635

Overview

Basic Information
Taxon OID	3300003310 Open in IMG/M
Scaffold ID	D1draft_1000635 Open in IMG/M
Source Dataset Name	Down-flow hanging sponge reactor microbial communities from the University of Illinois at Urbana-Champaign, USA - L1-648F-DHS
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	47543
Total Scaffold Genes	53 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	39 (73.58%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Down-Flow Hanging Sponge Reactor → Down-Flow Hanging Sponge Reactor Microbial Communities From The University Of Illinois At Urbana-Champaign, Usa

Source Dataset Sampling Location
Location Name	USA: University of Illionis
Coordinates	Lat. (^o)	40.114056	Long. (^o)	-88.226756	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105956	Metagenome / Metatranscriptome	100	N

Sequences

Protein ID	Family	RBS	Sequence
D1draft_100063550	F105956	N/A	MKTEEPALAEKLPIYMVAWSLPPAFVILAVVVLALDSFNEAGIAILKGKYMFLLLVGGTLLNLWFYAVRQFKLKRKFSPLHIIASLLFPVAYMSFYYGADTTLVVAICLVGIPVSIVSARQSMNMV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.